Host taxon 9606
Protein NP_005660.4
receptor expression-enhancing protein 5
Homo sapiens
Gene REEP5, UniProt Q00765
>NP_005660.4|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|receptor expression-enhancing protein 5
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.52 | 0.520327587655448 | 0.0051 | 25649146 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)