Host taxon 9606
Protein NP_001157994.1
ras-related protein Rab-7b isoform a
Homo sapiens
Gene RAB7B, UniProt Q96AH8
>NP_001157994.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ras-related protein Rab-7b isoform a
MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.34 | 2.34490379910882 | 0.00096 | 25649146 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)