Host taxon 9606
Protein NP_006859.2
ras-related protein Rab-31
Homo sapiens
Gene RAB31, UniProt Q13636
>NP_006859.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ras-related protein Rab-31
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.62 | -0.616293139134235 | 0.037 | 25649146 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)