Host taxon 9606
Protein NP_006393.2
ragulator complex protein LAMTOR5
Homo sapiens
Gene LAMTOR5, UniProt O43504
>NP_006393.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ragulator complex protein LAMTOR5
MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.07 | -1.06793702743288 | 2.1e-9 | 25649146 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)