Host taxon 9606
Protein NP_001276851.1
putative uncharacterized protein C22orf34
Homo sapiens
Gene C22orf34, UniProt Q6ZV56
>NP_001276851.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|putative uncharacterized protein C22orf34
MCTVDVEGFDDVGETLSDAVRDGLGTILRGGAEEGSYDNWPHTRKSWGPLSPGHQRELWTQPDPWTEVLSGHKGDAGACGCCCFCSQFINARCAHPLCLARGLDRRASEEMPILQALCLLPKVSTRSITVPSPQRSAPRASLCPPHKGKSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.45 | 0.446945160046111 | 0.041 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)