Host taxon 9606
Protein NP_001269086.1
putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform c
Homo sapiens
Gene FTSJ1, UniProt Q9UET6
>NP_001269086.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform c
MALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.46 | -0.459079759240715 | 0.014 | 25649146 | |
Retrieved 1 of 5 entries in 1.9 ms
(Link to these results)