Host taxon 9606
Protein NP_001277046.1
putative mitochondrial import inner membrane translocase subunit Tim23B isoform 1
Homo sapiens
Gene TIMM23B, UniProt B4DDK6
>NP_001277046.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|putative mitochondrial import inner membrane translocase subunit Tim23B isoform 1
MEGGGGSGDKTTGVLAGFFGAGEAGYSHADLAGVPLTGMNPLCPYLNVDPRYLVQDTDEFILPTGANKTWGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPGNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTVSEMALDSPFCVLLSGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.77 | 0.774129959088493 | 0.011 | 25649146 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)