Host taxon 9606
Protein NP_001034299.3
putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 isoform 3
Homo sapiens
Gene ALG13, UniProt Q9NP73
>NP_001034299.3|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 isoform 3
MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRCRKLFGDSGKRKATRSGYKRKVDEQSSAGTGKAATQRGSSLLLYLQHASWAVTVNGLINTEMLSSWPARKIFCIFG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.58 | 0.576911104834846 | 0.01 | 25649146 | |
Retrieved 1 of 3 entries in 1.4 ms
(Link to these results)