Host taxon 9606
Protein NP_005971.1
protein S100-P
Homo sapiens
Gene S100P, UniProt P25815
>NP_005971.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|protein S100-P
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ -2.33 | -2.32913302023561 | 0.0032 | 25649146 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)