Host taxon 9606
Protein NP_002957.1
protein S100-A10
Homo sapiens
Gene S100A10, UniProt P60903
>NP_002957.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|protein S100-A10
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.44 | 1.44389680611627 | 0.0092 | 25649146 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)