Host taxon 9606
Protein NP_002361.1
protein mago nashi homolog
Homo sapiens
Gene MAGOH, UniProt P61326
>NP_002361.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|protein mago nashi homolog
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.27 | -1.26799481613749 | 9.6e-11 | 25649146 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)