Host taxon 9606
Protein NP_115881.3
protein jagunal homolog 1 isoform a
Homo sapiens
Gene JAGN1, UniProt Q8N5M9
>NP_115881.3|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|protein jagunal homolog 1 isoform a
MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.36 | 0.360946303905228 | 0.025 | 25649146 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)