Host taxon 9606
Protein NP_001288763.1
protein C10 isoform 1
Homo sapiens
Gene C12orf57, UniProt Q99622
>NP_001288763.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|protein C10 isoform 1
MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.61 | -0.614594619454304 | 5.3e-5 | 25649146 | |
Retrieved 1 of 3 entries in 0.5 ms
(Link to these results)