Host taxon 9606
Protein NP_003901.2
protein BUD31 homolog
Homo sapiens
Gene BUD31, UniProt P41223
>NP_003901.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|protein BUD31 homolog
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.88 | -0.882289545443964 | 0.0002 | 25649146 | |
Retrieved 1 of 1 entries in 10 ms
(Link to these results)