Host taxon 9606
Protein NP_001124197.1
proteasome subunit beta type-5 isoform 2
Homo sapiens
Gene PSMB5, UniProt P28074
>NP_001124197.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|proteasome subunit beta type-5 isoform 2
MAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.3 | -0.304932546610269 | 0.025 | 25649146 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)