Host taxon 9606
Protein NP_004699.1
programmed cell death protein 5
Homo sapiens
Gene PDCD5, UniProt O14737
>NP_004699.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|programmed cell death protein 5
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.39 | -0.386805640151033 | 0.028 | 25649146 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)