Host taxon 9606
Protein NP_009107.1
probable ergosterol biosynthetic protein 28
Homo sapiens
Gene ERG28, UniProt Q9UKR5
>NP_009107.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|probable ergosterol biosynthetic protein 28
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.89 | 0.89218127144293 | 2.5e-5 | 25649146 | |
Retrieved 1 of 1 entries in 11.3 ms
(Link to these results)