Host taxon 9606
Protein NP_001271173.1
prepronociceptin isoform 2
Homo sapiens
Gene PNOC, UniProt Q13519
>NP_001271173.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|prepronociceptin isoform 2
MARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.64 | 1.64370818274469 | 0.046 | 25649146 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)