Host taxon 9606
Protein NP_002615.2
prefoldin subunit 5 isoform alpha
Homo sapiens
Gene PFDN5, UniProt Q99471
>NP_002615.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|prefoldin subunit 5 isoform alpha
MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.53 | -0.529126818347266 | 0.025 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)