Host taxon 9606
Protein NP_036526.2
prefoldin subunit 2
Homo sapiens
Gene PFDN2, UniProt Q9UHV9
>NP_036526.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|prefoldin subunit 2
MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.55 | -1.55173019729231 | 4.1e-14 | 25649146 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)