Host taxon 9606
Protein NP_000210.2
potassium voltage-gated channel subfamily E member 1
Homo sapiens
Gene KCNE1, UniProt P15382
>NP_000210.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|potassium voltage-gated channel subfamily E member 1
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ -2.45 | -2.45136637731604 | 7.0e-6 | 25649146 | |
Retrieved 1 of 5 entries in 1.4 ms
(Link to these results)