Host taxon 9606
Protein NP_036528.1
pleckstrin homology-like domain family A member 3
Homo sapiens
Gene PHLDA3, UniProt Q9Y5J5
>NP_036528.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|pleckstrin homology-like domain family A member 3
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.54 | -1.53558167572338 | 0.035 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)