Host taxon 9606
Protein NP_001034936.1
phospholipid hydroperoxide glutathione peroxidase isoform B precursor
Homo sapiens
Gene GPX4, UniProt P36969
>NP_001034936.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|phospholipid hydroperoxide glutathione peroxidase isoform B precursor
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFGHRLSTVPHRQERLRGEALRTHGGAPGDREGPAPLFLAPQVCGPARAPAHALGAFHRHS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.6 | -0.601246949744481 | 0.0078 | 25649146 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)