Host taxon 9606
Protein NP_002634.1
phosphatidylinositol-glycan biosynthesis class F protein isoform 1
Homo sapiens
Gene PIGF, UniProt Q07326
>NP_002634.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|phosphatidylinositol-glycan biosynthesis class F protein isoform 1
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.73 | 0.734315522988888 | 0.0021 | 25649146 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)