Host taxon 9606
Protein NP_036226.2
peroxiredoxin-5, mitochondrial isoform L precursor
Homo sapiens
Gene PRDX5, UniProt P30044
>NP_036226.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|peroxiredoxin-5, mitochondrial isoform L precursor
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.79 | -0.786609771551299 | 0.0003 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)