Host taxon 9606
Protein NP_001164218.1
peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 isoform 2
Homo sapiens
Gene PIN4, UniProt Q9Y237
>NP_001164218.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 isoform 2
MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGIPSLQQHAGHHRDLRSTLISLVSYLQTTP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.5 | -1.49682339514065 | 8.4e-5 | 25649146 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)