Host taxon 9606
Protein NP_848661.1
palmitoyltransferase ZDHHC21 isoform 1
Homo sapiens
Gene ZDHHC21, UniProt Q8IVQ6
>NP_848661.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|palmitoyltransferase ZDHHC21 isoform 1
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.67 | 0.667380391317408 | 0.00021 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)