Host taxon 9606
Protein NP_849190.2
organic solute transporter subunit beta
Homo sapiens
Gene SLC51B, UniProt Q86UW2
>NP_849190.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|organic solute transporter subunit beta
MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ -2.95 | -2.95452102277758 | 0.011 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)