Host taxon 9606
Protein NP_001017989.2
optic atrophy 3 protein isoform a
Homo sapiens
Gene OPA3, UniProt Q9H6K4
>NP_001017989.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|optic atrophy 3 protein isoform a
MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWLEMRTKMRIMGFNAAAIKPLNEGAAAELGAELLGEGIIFITACSCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATSTQLALEELRAQLQEVRAHLCLRDPPPAPPVAPASEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.63 | -0.627965361511239 | 0.025 | 25649146 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)