Host taxon 9606
Protein NP_073568.2
nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
Homo sapiens
Gene NUCKS1, UniProt Q9H1E3
>NP_073568.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.6 | -0.604173077944578 | 0.00066 | 25649146 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)