Host taxon 9606
Protein NP_001005176.1
nuclear body protein SP140 isoform 2
Homo sapiens
Gene SP140, UniProt Q13342
>NP_001005176.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|nuclear body protein SP140 isoform 2
MAQQGQQGQMASGDSNLNFRMVAEIQNVEGQNLQEQVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNLVPVTRVMYCVLSELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.21 | 1.21411383239703 | 0.033 | 25649146 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)