Host taxon 9606
Protein NP_115789.1
normal mucosa of esophagus-specific gene 1 protein
Homo sapiens
Gene C15orf48, UniProt A0A024R5U4
>NP_115789.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|normal mucosa of esophagus-specific gene 1 protein
MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.66 | 2.65816642277925 | 0.0093 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)