Host taxon 9606
Protein NP_001001349.1
NF-kappa-B inhibitor-interacting Ras-like protein 2 isoform a
Homo sapiens
Gene NKIRAS2, UniProt Q9NYR9
>NP_001001349.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|NF-kappa-B inhibitor-interacting Ras-like protein 2 isoform a
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.5 | -0.498600740638323 | 0.0027 | 25649146 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)