Host taxon 9606
Protein NP_064527.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
Homo sapiens
Gene NDUFA4L2, UniProt Q9NRX3
>NP_064527.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.58 | -1.58494360684601 | 0.0055 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)