Host taxon 9606
Protein NP_001171941.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 isoform 2
Homo sapiens
Gene NDUFA2, UniProt O43678
>NP_001171941.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 isoform 2
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYASRVQNS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.02 | -1.01766410505736 | 3.1e-7 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)