Host taxon 9606
Protein NP_057049.5
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Homo sapiens
Gene NDUFA13, UniProt Q9P0J0
>NP_057049.5|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.75 | -0.753200467202402 | 0.00048 | 25649146 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)