Host taxon 9606
Protein NP_001166037.2
myeloid differentiation primary response protein MyD88 isoform 5
Homo sapiens
Gene MYD88, UniProt Q99836
>NP_001166037.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|myeloid differentiation primary response protein MyD88 isoform 5
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIGAAGWWWLSLMITCRARNVTSRPNLHSASLQVPIRSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.58 | 2.57878660058778 | 0.00091 | 25649146 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)