Host taxon 9606
Protein NP_001009993.2
myelin-associated neurite-outgrowth inhibitor
Homo sapiens
Gene FAM168B, UniProt A1KXE4
>NP_001009993.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|myelin-associated neurite-outgrowth inhibitor
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.51 | -0.506815761795162 | 0.043 | 25649146 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)