Host taxon 9606
Protein NP_001139663.1
myelin protein zero-like protein 1 isoform c precursor
Homo sapiens
Gene MPZL1, UniProt O95297
>NP_001139663.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|myelin protein zero-like protein 1 isoform c precursor
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.6 | 0.597738068613107 | 1.6e-5 | 25649146 | |
Retrieved 1 of 3 entries in 1.6 ms
(Link to these results)