Host taxon 9606
Protein NP_001078957.1
modulator of macroautophagy TMEM150B isoform a
Homo sapiens
Gene TMEM150B, UniProt A6NC51
>NP_001078957.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|modulator of macroautophagy TMEM150B isoform a
MWGYLSLMPVFLAVWAISGVWIVFAIAVTNRTVDLSKGFPYISICGSFPPQSCIFSQVLNMGAALAAWICIVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGAFLAFILGNVYFWLQLLLWRLKRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSVSAACEWVVAMLLFALFGLLAVDFSALESCTLCVQPWPSLSPPPASPISLPVQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.68 | 1.67761857977899 | 0.011 | 25649146 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)