Host taxon 9606
Protein NP_001304160.1
mitochondrial carrier homolog 2 isoform 1x
Homo sapiens
Gene MTCH2, UniProt Q9Y6C9
>NP_001304160.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|mitochondrial carrier homolog 2 isoform 1x
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLIXRCGAGTVTFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ -3.04 | -3.04176723251355 | 0.009 | 25649146 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)