Host taxon 9606
Protein NP_001137298.1
microtubule-associated protein RP/EB family member 2 isoform 2
Homo sapiens
Gene MAPRE2, UniProt Q15555
>NP_001137298.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|microtubule-associated protein RP/EB family member 2 isoform 2
MAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.48 | 0.478629625766698 | 0.011 | 25649146 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)