Host taxon 9606
Protein NP_689850.2
methyltransferase-like protein 7B precursor
Homo sapiens
Gene METTL7B, UniProt Q6UX53
>NP_689850.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|methyltransferase-like protein 7B precursor
MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.35 | -1.35422439190816 | 2.7e-6 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)