Host taxon 9606
Protein XP_005252739.1
methylated-DNA--protein-cysteine methyltransferase isoform X1
Homo sapiens
Gene MGMT, UniProt P16455
>XP_005252739.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|methylated-DNA--protein-cysteine methyltransferase isoform X1
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.49 | 0.486908655271909 | 0.046 | 25649146 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)