Host taxon 9606
Protein NP_115662.2
mediator of RNA polymerase II transcription subunit 10
Homo sapiens
Gene MED10, UniProt Q9BTT4
>NP_115662.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|mediator of RNA polymerase II transcription subunit 10
MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.82 | -0.817359133050402 | 0.0088 | 25649146 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)