Host taxon 9606
Protein NP_001273546.1
MAP3K7 C-terminal-like protein isoform 2
Homo sapiens
Gene MAP3K7CL, UniProt P57077
>NP_001273546.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|MAP3K7 C-terminal-like protein isoform 2
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.04 | -1.03966227134817 | 7.5e-7 | 25649146 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)