Host taxon 9606
Protein NP_001317002.1
mannose-P-dolichol utilization defect 1 protein isoform 2
Homo sapiens
Gene MPDU1, UniProt O75352
>NP_001317002.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|mannose-P-dolichol utilization defect 1 protein isoform 2
MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKGAGDLPKSRLCGSWEPCWELSFSRQPPTTTTGTQASSQPSQSSCCLGAPWPESSLPFRKPEIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.63 | 0.628082818582663 | 0.0084 | 25649146 | |
Retrieved 1 of 4 entries in 0.7 ms
(Link to these results)