Host taxon 9606
Protein NP_001185612.1
leptin receptor gene-related protein isoform 3
Homo sapiens
Gene LEPROT, UniProt O15243
>NP_001185612.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|leptin receptor gene-related protein isoform 3
MAGVKALVALSFSGAIGLTFLMLGCALEDYGDATTPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.48 | 0.48436827580221 | 0.033 | 25649146 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)