Host taxon 9606
Protein NP_001030175.1
Kv channel-interacting protein 4 isoform 5
Homo sapiens
Gene KCNIP4, UniProt Q6PIL6
>NP_001030175.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|Kv channel-interacting protein 4 isoform 5
MSGCRKRCKREILKFAQYLLRLLTGSLHTDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.55 | 1.54741851349286 | 0.029 | 25649146 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)