Host taxon 9606
Protein NP_778231.2
juxtaposed with another zinc finger protein 1
Homo sapiens
Gene JAZF1, UniProt Q86VZ6
>NP_778231.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|juxtaposed with another zinc finger protein 1
MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.61 | 0.605114041588194 | 0.032 | 25649146 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)